SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021643 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021643
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-39
Family Second domain of FERM 0.000000579
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 4.45e-33
Family Moesin tail domain 0.0000222
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000611
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021643
Domain Number - Region: 434-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00889
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021643   Gene: ENSGGOG00000027218   Transcript: ENSGGOT00000029900
Sequence length 604
Comment pep:known_by_projection chromosome:gorGor3.1:11:107934582:108051408:-1 gene:ENSGGOG00000027218 transcript:ENSGGOT00000029900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSS
IKQM
Download sequence
Identical sequences A0A096MPS5 A0A2K5KAD1 A0A2K5N191 A0A2K6L457 A0A2K6Q7G4 G3S0P8 H2NF82 H2Q4Q6
ENSGGOP00000021643 ENSPPYP00000004412 NP_001247421.1.87134 NP_001247421.1.92137 NP_001247422.1.87134 NP_001247422.1.92137 XP_003952066.1.37143 XP_004052139.1.27298 XP_008969422.1.60992 XP_011782075.1.43180 XP_011847515.1.47321 XP_011847522.1.47321 XP_011921855.1.92194 XP_011921856.1.92194 XP_016777447.1.37143 XP_017738738.1.44346 ENSPTRP00000007326 ENSGGOP00000021643 ENSPPYP00000004412 ENSPTRP00000007326 ENSP00000384136 ENSP00000432112 ENSP00000437301 ENSP00000342830 ENSPANP00000001742 9598.ENSPTRP00000007326 ENSP00000384136 ENSP00000432112 ENSP00000437301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]