SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021664 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021664
Domain Number 1 Region: 150-267
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-37
Family Link domain 0.0015
Further Details:      
 
Domain Number 2 Region: 263-351
Classification Level Classification E-value
Superfamily C-type lectin-like 1.32e-22
Family Link domain 0.0051
Further Details:      
 
Domain Number 3 Region: 1032-1129
Classification Level Classification E-value
Superfamily C-type lectin-like 9.44e-19
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 4 Region: 44-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000238
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 5 Region: 997-1038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021664   Gene: ENSGGOG00000002977   Transcript: ENSGGOT00000029265
Sequence length 1143
Comment pep:known_by_projection chromosome:gorGor3.1:19:19598936:19620843:1 gene:ENSGGOG00000002977 transcript:ENSGGOT00000029265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATFVWALGLLMLQMLLFVAGEQGTQDIADASERGLHMQKLGSGSVRAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRHR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQEHYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQVRTVYRFANRTGFPSPAERFDAYCFRAHHPTSQHGDLETPS
SGDEGEILSAEGPPVRELEPTLEEEEGVTPDFQEPLVSSGEEEPLILEEKQESQQTLSPT
PGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPTPRRRGRFKGLNGRYFQ
QQEPEPGLQGGMEASAQPPTSEAAGNQMEPPLAMAVTEMLGSGQSRSPWADLTNEVDMPG
AGSAGGKNSPEPWLWPPTMVPSSISGHSRAPVLELEKAEGPSARPATPDLFWSPLEATVS
APSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAHGEATATAPPSPA
AETKVYSLPLSSTPTGQGGEAMPTTPESPRADFRETGKTSPAQVNKAEHSSSSPWPSVNR
NVAVGFVPTETATAPTGLRDISGSESGVFDTAESPTSGLQATVDEVQDPWPSVYSKGLDA
RSPSALLGSPGVFLVPKVTPSLEPWVATDEGPTVNPMDSTVTPAPSDASGIWEPGSQVFE
EAQSTTLSPQVALDTSTVTPLTTLEQGDKVGVPAMSTLGSSSSQPDPEPEDQVETQGTSG
ASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLLPVTLGIEDFELE
VLAGSPGVESSWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHGGTCNANGTMYGC
SCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSFCEKDTEGCDRGW
HKFQGHCYRYFAHRRAWEDAERDCRRRSGHLTSVHSPEEHSFINSRGSGEGATCLEGGQG
WHL
Download sequence
Identical sequences ENSGGOP00000021664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]