SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021702 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021702
Domain Number - Region: 56-124
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00262
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021702   Gene: ENSGGOG00000024769   Transcript: ENSGGOT00000024126
Sequence length 202
Comment pep:known_by_projection chromosome:gorGor3.1:1:135012645:135024576:-1 gene:ENSGGOG00000024769 transcript:ENSGGOT00000024126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLSSRLCGSGRALGMPMMRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLT
LQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAG
YFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSI
GIPLLLWYSSKRKYDTPKTKKN
Download sequence
Identical sequences G3S0V7
ENSGGOP00000021702 ENSGGOP00000021702 XP_018879734.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]