SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021715 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021715
Domain Number 1 Region: 23-104
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 0.0000000000786
Family Nucleoside diphosphate kinase, NDK 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021715   Gene: ENSGGOG00000028159   Transcript: ENSGGOT00000023910
Sequence length 112
Comment pep:novel chromosome:gorGor3.1:7:138782779:138786854:-1 gene:ENSGGOG00000028159 transcript:ENSGGOT00000023910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFRPDTAASVEHHPSSGGPSWTLERTLVVVKPDGAQRRLVGDGIRFERRLHAGSSVVPR
PGTIQGDFSAHISRNFFQASNSVEGARRWIPLLPSRDLVSWARRQHSRSHPA
Download sequence
Identical sequences ENSGGOP00000021715 ENSGGOP00000021715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]