SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021723 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021723
Domain Number 1 Region: 86-174
Classification Level Classification E-value
Superfamily HMG-box 9.03e-29
Family HMG-box 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021723   Gene: ENSGGOG00000006906   Transcript: ENSGGOT00000028948
Sequence length 446
Comment pep:known_by_projection chromosome:gorGor3.1:16:1059396:1064451:1 gene:ENSGGOG00000006906 transcript:ENSGGOT00000028948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDMSEARSQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGGAVGGARGDPAEAA
DERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGALKAKPHVKRPMNAFMVWAQAARRKL
ADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAK
AGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTHGPPTPPTTPKTELQQAGA
KPELKLEGRRPADSGRQNIDFSNVDISELSSEVMGTMDAFDVHEFDQYLPLGGPAPPEPG
QAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGDQPRGSPDYGS
CGGQASATPAAPAGPFAGAQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLL
NGLALPPAHSPTSHWDQPVYTTLTRP
Download sequence
Identical sequences G3S0X8
ENSGGOP00000021723 ENSGGOP00000006754 XP_004056967.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]