SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021743 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021743
Domain Number 1 Region: 238-436
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.2e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 453-525
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000294
Family Blood coagulation inhibitor (disintegrin) 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021743
Domain Number - Region: 681-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021743   Gene: ENSGGOG00000003536   Transcript: ENSGGOT00000027989
Sequence length 766
Comment pep:known_by_projection chromosome:gorGor3.1:5:39304153:39325122:-1 gene:ENSGGOG00000003536 transcript:ENSGGOT00000027989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRGAGRDPGAAPLLSXLPPPGLGTQGPAGALRWGGLPQLLPGPSCLPEEAERRRAVEADS
AGISRPRMVPIRSQPPGLQPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSRE
GTTQHSTGAGDHCYYQGKLRGNPHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAP
QGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKY
VELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ
VQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEY
GNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLT
HDAMCSDGLCCRRCKHSSLGQPSAPVLGLLRSTPPLSPQCPPNLHKLDGYYCDHEQGRCY
GGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLC
VNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLD
HRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGE
TERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences ENSGGOP00000021743 ENSGGOP00000003479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]