SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021753 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021753
Domain Number 1 Region: 163-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-60
Family Voltage-gated potassium channels 0.00055
Further Details:      
 
Domain Number 2 Region: 37-134
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021753   Gene: ENSGGOG00000027559   Transcript: ENSGGOT00000023702
Sequence length 495
Comment pep:known_by_projection chromosome:gorGor3.1:12:5044436:5046009:1 gene:ENSGGOG00000027559 transcript:ENSGGOT00000023702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTGNCTT
ANQNCVNKSKLLTDV
Download sequence
Identical sequences A0A2K5BVL7 A0A2K5RLP0 A0A2K6V964 G3S108 H2Q593 U3DUA2
ENSPTRP00000007794 ENSGGOP00000021753 9598.ENSPTRP00000007794 XP_003313484.1.37143 XP_003820378.1.60992 XP_003942228.1.74449 XP_012311338.1.9421 XP_017401660.1.71028 XP_018894964.1.27298 ENSGGOP00000021753 ENSPTRP00000007794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]