SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021762 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021762
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 9.45e-36
Family MHC antigen-recognition domain 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021762   Gene: ENSGGOG00000000700   Transcript: ENSGGOT00000031952
Sequence length 88
Comment pep:novel chromosome:gorGor3.1:6:33421856:33531771:-1 gene:ENSGGOG00000000700 transcript:ENSGGOT00000031952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLEQAKCECHILNGTERVQYLNRYIHKREENLRFDSDVGEFQAVTELGRPVAEKWNSQK
EILEEKRDKVDTYCRYSYGVFESFTVPR
Download sequence
Identical sequences O19299
ENSGGOP00000021762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]