SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021785 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021785
Domain Number 1 Region: 422-497
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 2.22e-29
Family VHP, Villin headpiece domain 0.0000348
Further Details:      
 
Domain Number 2 Region: 30-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.61e-16
Family LIM domain 0.0026
Further Details:      
 
Domain Number 3 Region: 88-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000176
Family LIM domain 0.00092
Further Details:      
 
Domain Number 4 Region: 3-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000524
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021785   Gene: ENSGGOG00000009142   Transcript: ENSGGOT00000024979
Sequence length 497
Comment pep:known_by_projection chromosome:gorGor3.1:4:8396162:8510503:-1 gene:ENSGGOG00000009142 transcript:ENSGGOT00000024979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFG
IRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAART
EDRNKETRTSSESIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPD
MISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP
AGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRGGSESGRSTPSLSVLSDSKPPPSTYQQ
APRHFHVPDTGVKDNIYRKPPIYRQHAARRSDGEDGSLDQDNRKQKSSWLMLKGDADTRT
NSPDLDTQSLSHSSGTDRDPLQRMAGDSFHSLFLISQADPIPGAGERSVDRRNANLAPCG
ADPDASWGMREYKIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSVEEFD
RLALWKRNDLKKKALLF
Download sequence
Identical sequences ENSGGOP00000021785 ENSGGOP00000008946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]