SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021786 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021786
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily SAP domain 5.8e-19
Family SAP domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021786
Domain Number - Region: 336-401
Classification Level Classification E-value
Superfamily RING/U-box 0.0494
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021786   Gene: ENSGGOG00000025821   Transcript: ENSGGOT00000028919
Sequence length 613
Comment pep:known_by_projection chromosome:gorGor3.1:18:44343837:44425698:-1 gene:ENSGGOG00000025821 transcript:ENSGGOT00000028919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRT
LEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKP
TFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQV
REICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPP
KNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRL
KMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCF
DAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMR
PKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKR
KCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDL
PGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVIT
SSGSNIPDIISLD
Download sequence
Identical sequences G3SCL6
ENSGGOP00000021786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]