SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021814 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021814
Domain Number 1 Region: 178-274
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-33
Family Nuclear receptor ligand-binding domain 0.0000644
Further Details:      
 
Domain Number 2 Region: 3-36
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000907
Family Nuclear receptor 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021814   Gene: ENSGGOG00000023359   Transcript: ENSGGOT00000029297
Sequence length 288
Comment pep:novel chromosome:gorGor3.1:19:17564345:17577433:-1 gene:ENSGGOG00000023359 transcript:ENSGGOT00000029297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEELKRPGTPHKGLSPAPFSCRSCLPQLPP
TPASEASSLALTPCPCRLICFLAEISELGCVKNYKGVKWFLFAVVFWSRPWWEKLREAER
KSSKALGWECGHLTQTQGPLGAGFNPCPGFSAQLCSPPASARVPLRCLLYTELTWSSRRQ
VDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLR
LPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Download sequence
Identical sequences ENSGGOP00000021814 ENSGGOP00000021814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]