SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021817 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021817
Domain Number 1 Region: 1716-1961
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.48e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 759-892
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000832
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1070-1211
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000863
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 531-660
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000507
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 5 Region: 349-472
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000105
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 468-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000779
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 879-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000895
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 119-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 9 Region: 197-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1041-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 235-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 159-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 962-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1404-1437
Classification Level Classification E-value
Superfamily Notch domain 0.0000000772
Family Notch domain 0.0035
Further Details:      
 
Domain Number 15 Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 16 Region: 314-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 924-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 696-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000411
Family EGF-type module 0.038
Further Details:      
 
Domain Number 20 Region: 1323-1354
Classification Level Classification E-value
Superfamily Notch domain 0.00000111
Family Notch domain 0.0015
Further Details:      
 
Domain Number 21 Region: 1363-1395
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 22 Region: 82-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000301
Family EGF-type module 0.017
Further Details:      
 
Domain Number 23 Region: 1009-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000393
Family EGF-type module 0.04
Further Details:      
 
Domain Number 24 Region: 653-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000812
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 25 Region: 734-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.023
Further Details:      
 
Domain Number 26 Region: 41-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.014
Further Details:      
 
Domain Number 27 Region: 1209-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000043
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021817
Domain Number - Region: 1251-1290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0328
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021817   Gene: ENSGGOG00000002258   Transcript: ENSGGOT00000023262
Sequence length 2245
Comment pep:known_by_projection chromosome:gorGor3.1:19:15446304:15485930:-1 gene:ENSGGOG00000002258 transcript:ENSGGOT00000023262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPCLDGSPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVA
GTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDV
DECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLT
YDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQ
LQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCA
CPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGA
NPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMA
GFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNG
AKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRC
ESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGIN
RYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPC
AHEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCT
CPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAP
CGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGF
AGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTC
VDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQT
LVDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGG
QCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNC
EDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHN
GTCVDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFS
GPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPDPQPFWGPRCERVARSCRE
LQCPVGVPCQQTPRGPRCACPLGLSGSSCRSFPGSPPGASNASCAAAPCLHGGSAPEVSE
EPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCPVSGGDPWRQCEALQCWRLFNNSRCD
PACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASE
VPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSP
GSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFP
YPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGFSLH
KDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEE
AVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGAL
EPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGA
DTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVE
ELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREG
SYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLL
CPPGAFLPGLKAAQSGSKKSRRPPGKKLTLACPGPLADSSVTLSPVDSLDSPRPFGGPPA
SPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLP
PPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFL
RVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATSTGALPAQPLPLSV
PSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences ENSGGOP00000021817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]