SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021818
Domain Number 1 Region: 26-235
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0000000105
Family Glycerol-3-phosphate (1)-acyltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021818   Gene: ENSGGOG00000014835   Transcript: ENSGGOT00000023424
Sequence length 366
Comment pep:known_by_projection chromosome:gorGor3.1:8:6579936:6633173:1 gene:ENSGGOG00000014835 transcript:ENSGGOT00000023424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSLVLHTYSMRYLLPSVVLLGTAPTYVLAWGVWRLLSAFLPARFYQALDDRLYCVYQS
MVLFFFENYTGVQILLYGDLRKSSKHSIFSGNYIKLLITVISDLYDIKKKSKLYILLFAR
EVAFFMTLANCYFKMWQHGGIYVKRSAKFNEKEMRNKLQSYVDAGTPMYLVIFPEGTRYN
PEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDCMKNYLDAIYDVTVVYEGKDDG
GQRRESPTMTDFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYES
PDPERRKRFPGKSINSKLSIKKTLPSMLILSGLTAGMLMTDAGRKLYVNTWIYGTLLGCL
WVTIKA
Download sequence
Identical sequences ENSGGOP00000021818 ENSGGOP00000014478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]