SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021846 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021846
Domain Number 1 Region: 50-191,354-468,847-1068
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.32e-121
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 473-492,631-901
Classification Level Classification E-value
Superfamily HAD-like 2.96e-50
Family Meta-cation ATPase, catalytic domain P 0.00026
Further Details:      
 
Domain Number 3 Region: 480-691
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.58e-46
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0049
Further Details:      
 
Domain Number 4 Region: 193-291
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.54e-27
Family Calcium ATPase, transduction domain A 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021846   Gene: ENSGGOG00000014187   Transcript: ENSGGOT00000024427
Sequence length 1251
Comment pep:known_by_projection chromosome:gorGor3.1:12:88476031:88543625:-1 gene:ENSGGOG00000014187 transcript:ENSGGOT00000024427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEVGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAI
VSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKID
ESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGLSRT
QFENQHSNDSNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEK
SVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKF
FIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGT
LTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPR
HVGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIF
SKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGE
PEPEWDNENDIVTGLTCIAVVGIEDPVRPEVVPDAIKKCQRAGITVRMVTGDNINTARAI
ATKCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVK
GIIDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSI
VKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLA
SLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDS
GRNAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFV
VQIIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQK
EEIPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGSSIQGALRRQP
SIASQHHDIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRIEDSEPHIPLIDDTDAED
DAPTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL
Download sequence
Identical sequences ENSGGOP00000021846 ENSGGOP00000021846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]