SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021893 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021893
Domain Number 1 Region: 45-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-53
Family Dual specificity phosphatase-like 0.0000000636
Further Details:      
 
Domain Number 2 Region: 199-376
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-48
Family Dual specificity phosphatase-like 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021893   Gene: ENSGGOG00000027917   Transcript: ENSGGOT00000029329
Sequence length 457
Comment pep:novel chromosome:gorGor3.1:7:49989128:50186247:1 gene:ENSGGOG00000027917 transcript:ENSGGOT00000029329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKSKGRWSWAAAPWCSPRCSLTSPGVKKMRSSTQQDPRRRDPQDDVYLDITDRLRFAI
LYSRPKSATNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEAAYRILIFGDTPYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKRFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIGPQQQFL
VMKQTSLWLEGDYFRQKLKGQENGQYRAAFSKLLSGVDDISINGVENQDQQEPNPYSDDD
EINGVTQGDRRRALKRRRQSKTNSPPLTILLRTKAQT
Download sequence
Identical sequences ENSGGOP00000021893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]