SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021910 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021910
Domain Number 1 Region: 298-379
Classification Level Classification E-value
Superfamily HMG-box 1.7e-21
Family HMG-box 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021910   Gene: ENSGGOG00000010692   Transcript: ENSGGOT00000027261
Sequence length 399
Comment pep:known_by_projection chromosome:gorGor3.1:4:117411885:117559333:-1 gene:ENSGGOG00000010692 transcript:ENSGGOT00000027261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
Download sequence
Identical sequences A0A096NXR8 A0A1D5REM7 A0A2I3S5R9 A0A2K5E0B7 A0A2K5H841 A0A2K5MCN8 A0A2K5XU45 A0A2K6DZX7 A0A2K6QWB1 G3R560 G7P623 H2PE30
ENSPPYP00000016739 ENSGGOP00000010428 ENSGGOP00000021910 ENSMMUP00000030608 ENSGGOP00000010428 ENSPPYP00000016739 9544.ENSMMUP00000034904 9598.ENSPTRP00000028092 9600.ENSPPYP00000016739 ENSPTRP00000028092 ENSMMUP00000034904 XP_001136065.1.37143 XP_003776559.1.23681 XP_003830045.1.60992 XP_005555692.1.63531 XP_010371504.1.97406 XP_011747398.1.29376 XP_011801119.1.43180 XP_011845202.1.47321 XP_011884358.1.92194 XP_012291955.1.9421 XP_014994468.1.72884 XP_017708562.1.44346 ENSPANP00000017870 ENSPTRP00000028092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]