SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021915 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021915
Domain Number 1 Region: 150-276
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-32
Family Pleckstrin-homology domain (PH domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 311-419
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 17-76
Classification Level Classification E-value
Superfamily Phenylalanine zipper 3.66e-21
Family Adapter protein APS, dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021915   Gene: ENSGGOG00000003254   Transcript: ENSGGOT00000024648
Sequence length 535
Comment pep:known_by_projection chromosome:gorGor3.1:12:110956725:110988961:1 gene:ENSGGOG00000003254 transcript:ENSGGOT00000024648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPALQPSSASSAPSAWSEFCELHAVAAARELARQYWLFAREHPQHAPLRAELVSLQFT
DLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEECSFQH
FRRSLRHIFRRRSAGELPETPARPGLAKKLLPWSLAREPPPEALKEAVLRYSLADEASMD
SGARWQRGRLALRRAPGPDGPDRVLELFDPPKSSRPKLQAACSSIQEVRRCTQLEMPDNL
YTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPR
GSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVR
QSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVDMLHHFQRSPIPLECGA
ACDVRLSSYVVVVSQPPGSCNTVLFPFSLPHWDSELGLPHLSSTGCPRGLSPEGLPGRSS
PPEQIFHLVPSPEELANSLRHLEHEPVNRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences ENSGGOP00000021915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]