SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021935 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021935
Domain Number - Region: 67-141
Classification Level Classification E-value
Superfamily PA domain 0.000379
Family PA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021935   Gene: ENSGGOG00000011476   Transcript: ENSGGOT00000025787
Sequence length 483
Comment pep:known_by_projection chromosome:gorGor3.1:5:38212555:38216569:-1 gene:ENSGGOG00000011476 transcript:ENSGGOT00000025787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAHVVSENWSKDYCLLFSSDYIALPRDLHHAPLLPLYDGTKAPWCPGEDSPHQAQLRSPS
QRPLRQTTAMVMRGNCSFHAKGWLAQGQGAHGLLIVSRCSDTTLAPQDPRQPLADLTIPV
AMLQYADMLDILSHTRGEAVVHVAMYAPPEPIIDYNMLVIFILAVGTVAAGGYWAGLTEA
NRLQRRRARRGGGPEDNEDIPVDFTPAMTGVVVTLSCSLMLLLYFFYDHFIYVTIGIFGL
GAGIGLYSCLSPLVCRLPLRQYQRPPHSLWASLPLPLLLLASLCTTVIIFWVAYRNKDRW
AWLLQDTLGISYCLFVLHRVQLPTLKNCSSFLLALLAFDVFFVFVTPFFTKTGESIMAQV
ALGPAESSSHERLPMVLKVPQLRVSTLTLCSQPFSILGFGDIVVPGFLVAYCCRFDVQVR
SRQVYFVACTMAYAVGLLVTFMAMVLMQMGQPALLYLVSSTLLTSLAVAACRQELSLFWT
GQG
Download sequence
Identical sequences ENSGGOP00000021935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]