SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021936 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021936
Domain Number 1 Region: 1043-1063,1204-1407
Classification Level Classification E-value
Superfamily HAD-like 9.15e-57
Family Meta-cation ATPase, catalytic domain P 0.00021
Further Details:      
 
Domain Number 2 Region: 837-923
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.22e-24
Family Calcium ATPase, transduction domain A 0.0031
Further Details:      
 
Domain Number 3 Region: 8-80
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 5.63e-21
Family HMA, heavy metal-associated domain 0.0000101
Further Details:      
 
Domain Number 4 Region: 1069-1128,1181-1237
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.54e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0024
Further Details:      
 
Domain Number 5 Region: 376-448
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.49e-20
Family HMA, heavy metal-associated domain 0.0000158
Further Details:      
 
Domain Number 6 Region: 167-243
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.93e-19
Family HMA, heavy metal-associated domain 0.00000771
Further Details:      
 
Domain Number 7 Region: 488-558
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 4.84e-17
Family HMA, heavy metal-associated domain 0.0011
Further Details:      
 
Domain Number 8 Region: 274-340
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000000111
Family HMA, heavy metal-associated domain 0.0011
Further Details:      
 
Domain Number 9 Region: 788-821,924-1039,1351-1390
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000615
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021936
Domain Number - Region: 102-147
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00615
Family HMA, heavy metal-associated domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021936   Gene: ENSGGOG00000025640   Transcript: ENSGGOT00000029066
Sequence length 1503
Comment pep:known_by_projection chromosome:gorGor3.1:X:75065842:75140488:1 gene:ENSGGOG00000025640 transcript:ENSGGOT00000029066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPK
TLQEAIDDMGFDAVLHNPDPLPVLTDTLFLTVTASLTLPWDHIQSTLLKTKGVTDIKIYP
QKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGM
TCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKK
QPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESTLS
ALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSS
SSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVE
YDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQD
KEEGKTSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPP
MIAEFIRELGFGATVIENADEGDGVLELVVSKIFCVINNISSKISSSLSKNSNGFYMFLR
ITANKCKMAAFPLAVGNVMCITIYGQSLGFEASLVKKDRSASHLDHKREIRQWRRSFLVS
LFFCIPVMGLMIYMMVMDHHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNLLSF
LLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNP
ITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQV
DVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQN
GSLLICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWI
VIGFLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTG
VGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLTESNRISHHKILAIV
GTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNI
EDNNIKHASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINN
DVNDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDN
SKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIA
IGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVF
MPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH
VGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDD
TAL
Download sequence
Identical sequences ENSGGOP00000021936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]