SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021946 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021946
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 210-257
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000129
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021946   Gene: ENSGGOG00000014933   Transcript: ENSGGOT00000033144
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:3:51918883:51924259:-1 gene:ENSGGOG00000014933 transcript:ENSGGOT00000033144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCVQGPCPLLAVERTGQRPLWAPSLELPEPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVANVDC
LPLPRRMADYLRQYPFQL
Download sequence
Identical sequences ENSGGOP00000021946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]