SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021962 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021962
Domain Number 1 Region: 58-197
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.08e-43
Family Gelsolin-like 0.000000283
Further Details:      
 
Domain Number 2 Region: 425-569
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.01e-38
Family Gelsolin-like 0.000000213
Further Details:      
 
Domain Number 3 Region: 658-774
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.78e-34
Family Gelsolin-like 0.000000561
Further Details:      
 
Domain Number 4 Region: 295-406
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.6e-29
Family Gelsolin-like 0.000000996
Further Details:      
 
Domain Number 5 Region: 178-282
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.73e-28
Family Gelsolin-like 0.00000259
Further Details:      
 
Domain Number 6 Region: 555-657
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.74e-20
Family Gelsolin-like 0.00000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021962   Gene: ENSGGOG00000010202   Transcript: ENSGGOT00000025335
Sequence length 783
Comment pep:known_by_projection chromosome:gorGor3.1:9:104084997:104118002:1 gene:ENSGGOG00000010202 transcript:ENSGGOT00000025335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRRVPEARPNSMVVEHPEF
LKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNE
CSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHV
VPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRFERLK
ATQVSKGIRDNERSGRARVHVSEEGAEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAK
LYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAAL
KTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVER
VPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYN
YRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLF
GGKPMIIYKGGTSREGGQTDPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTP
SAAYLWVGTGASEAEKMGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKD
KKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEE
KTEALTSAKRYIETDPASRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAE
LAA
Download sequence
Identical sequences ENSGGOP00000021962 ENSGGOP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]