SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021967 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021967
Domain Number 1 Region: 133-265
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 31-135
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021967
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00107
Family First domain of FERM 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021967   Gene: ENSGGOG00000004192   Transcript: ENSGGOT00000023831
Sequence length 777
Comment pep:known_by_projection chromosome:gorGor3.1:9:91543189:91668877:-1 gene:ENSGGOG00000004192 transcript:ENSGGOT00000023831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCP
YETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQ
AELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMD
FKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNR
SDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLC
SKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSSSDRLPFGIEENGGTPFL
TAASGTNYSLSLTLENKEGPLRSPNSSSKSLTKLTPGTPALFSEAAAHLKKLELETVKAA
GPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEES
PFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFNRSDEDDLPP
DLAEAVGVTTSTTTNTTTAATQVSVPLPSPKVQNVSSPHKSEGKGLLSPGAKSPSDRGGA
FTLEPGDLLMDFTEATPLAEPASNPHCAHSRCSPPLSLPMKEETTGVCMYPPIKTRLIKT
FPVDTMNPFPDTFTTGPQFTADFRDSKLQCCPGPTSPLIPAATLRPLTETISTVQTIYTP
ETCVSGSQCRDTPAGTGEREDDEKTVDDRTVKFSPCHLEDGMVPSVRLLSSGFVCSL
Download sequence
Identical sequences ENSGGOP00000021967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]