SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021978 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021978
Domain Number 1 Region: 1418-1530
Classification Level Classification E-value
Superfamily C-type lectin-like 3.3e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000384
Further Details:      
 
Domain Number 2 Region: 1306-1415
Classification Level Classification E-value
Superfamily C-type lectin-like 4e-43
Family Noncollagenous (NC1) domain of collagen IV 0.0000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021978   Gene: ENSGGOG00000003128   Transcript: ENSGGOT00000025337
Sequence length 1532
Comment pep:known_by_projection chromosome:gorGor3.1:2b:116320873:116386720:1 gene:ENSGGOG00000003128 transcript:ENSGGOT00000025337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKGFPGLPGTLGYPGIPGAAGLKGQKGAPAKGEDIELDAKGDPGLPGAPGPQGLPGPPG
FPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIVTLT
GPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDAGPQGKPGKDGVPGFPG
SEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGEEGTPGPPGPRGARG
PQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLP
GSPGPPGPPGDIVFRKGPPGDRGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLP
GLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQ
VGAPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELYGASSSQALPWPSPRGPCCFSGC
YHMGDPSLKEAAVLTSMLGYKQETGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGS
LGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDKGFPGTKGSLGCPGKMGEPGLPGKPGLP
GAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPVTPGNEGLDGPRGDPGQPG
PPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSGFPGETGSP
GMPGHQGKMGPPGQKGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGTPGNPGTPGQRGSP
GIPGVKGQRGTPGAKGEQGDKGNPGPSEISHIIGDKGEPGLKGFAGNPGEKGNRGIPGMP
GLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRA
GRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAG
PEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPTGIRGDQG
RDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPT
GIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGEPGPPGPPGSHVIGIKGDKGSMGHPGP
KGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGP
KGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGK
PGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPAAWTTRGFVFTRHSQTTAIP
SCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRND
YSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLW
KGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNP
ERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
Download sequence
Identical sequences ENSGGOP00000021978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]