SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022034 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022034
Domain Number 1 Region: 167-198
Classification Level Classification E-value
Superfamily WW domain 0.000000000291
Family WW domain 0.0011
Further Details:      
 
Domain Number 2 Region: 126-158
Classification Level Classification E-value
Superfamily WW domain 0.00000000719
Family WW domain 0.00024
Further Details:      
 
Domain Number 3 Region: 8-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000028
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022034   Gene: ENSGGOG00000026935   Transcript: ENSGGOT00000022611
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:13:23117220:23138999:1 gene:ENSGGOG00000026935 transcript:ENSGGOT00000022611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKA
SKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKK
DPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGNLKKTAVKTVWVEGLSEDGFTYY
YNTETGESRWEKPDDFIPHTSDLPSSKVSENSLGTLDESKSSDSHSDSDWEQEAEEGGVS
TETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIK
QEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRRT
ENGKSRNLRQRGDDQ
Download sequence
Identical sequences ENSGGOP00000022034 ENSGGOP00000022034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]