SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022043 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022043
Domain Number 1 Region: 61-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-29
Family Ankyrin repeat 0.00077
Further Details:      
 
Domain Number 2 Region: 404-446
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000589
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022043   Gene: ENSGGOG00000010951   Transcript: ENSGGOT00000028029
Sequence length 453
Comment pep:known_by_projection chromosome:gorGor3.1:5:39918171:39926922:-1 gene:ENSGGOG00000010951 transcript:ENSGGOT00000028029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARETFPFTSSTLRSLRLQQEWLEWEDRRQAAAQQCRSRRCPSSPRARLTRPHCSCRDPA
VHHALFSGNLQQVQALFQDEEAANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLAIATA
RGYTDCRHLIRQGAELDACVGGRAALHEACARAQLDCVRLLLTFGAKANVLTEEGTTPLH
LCTIPESLQCAKLLLEAGATVNLAAGESQETPLHVAAARGLEQHVALYLEHGADVGLRTS
QGETALNAACAGAEGAGSCRHCWTTGRSQCALRRLLCGGARGWNCSASGEDRGSKRLKAC
PQRPGGCPQLGRGREDSGRESPREGRAPEENWGQKGGVDRGTEKERETQTLAPQMLKHCA
NFPRALEVLLNAYPCVPSCETWVEAVLPELWKEHEAFYSSALCMVNQPRRLQHLARLAVR
ARLGSRCRQGATRLPLPPLLRDYLLLRVEGCIQ
Download sequence
Identical sequences ENSGGOP00000022043 ENSGGOP00000010670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]