SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022060 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022060
Domain Number 1 Region: 2-281
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.01e-72
Family Rhodopsin-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022060   Gene: ENSGGOG00000025358   Transcript: ENSGGOT00000031174
Sequence length 283
Comment pep:known_by_projection chromosome:gorGor3.1:11:52817759:52819576:1 gene:ENSGGOG00000025358 transcript:ENSGGOT00000031174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTVLGNLGLITLIRMDSQLHTPMY
FFLSNLAFIDVFYSSTVTPKALVNFQSNRRSISFVGCFVQMYFFVGLVCCECFLLGSMAY
DRYVAICNPLLYSVVMSQKVSNWLGVMPYVIGFTNLLISAWVISSLAFCDSSINHFFCDT
TALLALSCVDTFRTEMVSFVLAGFTLLSSLLIITVTYVTIISAILRIQSAADRQKAFSTC
ASHLMASVFYTIVIPMLNPLIYSLRNKDVKNALLRVIHRKLFP
Download sequence
Identical sequences ENSGGOP00000022060 ENSGGOP00000022060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]