SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022070 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022070
Domain Number 1 Region: 24-133,246-339,689-899
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.23e-119
Family Calcium ATPase, transmembrane domain M 0.00015
Further Details:      
 
Domain Number 2 Region: 343-363,480-742
Classification Level Classification E-value
Superfamily HAD-like 2.64e-54
Family Meta-cation ATPase, catalytic domain P 0.00011
Further Details:      
 
Domain Number 3 Region: 135-245
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-25
Family Calcium ATPase, transduction domain A 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022070   Gene: ENSGGOG00000002535   Transcript: ENSGGOT00000024519
Sequence length 946
Comment pep:known_by_projection chromosome:gorGor3.1:3:130958426:131046687:1 gene:ENSGGOG00000002535 transcript:ENSGGOT00000024519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARFQKIPNGENETMIPVLTSKKASELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNE
FDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQGV
EAKKPEEIAMVVSISCYSVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSI
DESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGE
VFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAV
AAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVT
HIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTLMG
KPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAY
EQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVG
IIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMD
VQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQ
TGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLM
NFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSS
IIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKM
FCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSRE
KIQKHVSSTSSSFLEVWLWERSGQQLVEIHPHLETGLPLTEDVSCV
Download sequence
Identical sequences ENSGGOP00000022070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]