SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022076 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022076
Domain Number 1 Region: 258-391
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-26
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 2 Region: 14-156
Classification Level Classification E-value
Superfamily PR-1-like 4.45e-23
Family PR-1-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022076   Gene: ENSGGOG00000009747   Transcript: ENSGGOT00000032942
Sequence length 401
Comment pep:novel chromosome:gorGor3.1:16:60371805:60386603:1 gene:ENSGGOG00000009747 transcript:ENSGGOT00000032942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHPETSPGWGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLDWSDSLAQLAQARAALCGTPTPSLASGPWRTLQVGLVWATSTQLGCGR
HLCSAGQAAIEAFVCAYSPGGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLC
EVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIG
YGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDI
LAFYLGRLETTNEVIDSDFETTNFWIGLTYKTAKDSFRWATGEHQAFTSFAFEQPDNHGF
GNCVELQASAAFNWNDQCCKTRNRYICQFAQEHISQWGPGS
Download sequence
Identical sequences G3S1Y0
ENSGGOP00000022076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]