SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022105 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022105
Domain Number 1 Region: 17-123,312-616
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-67
Family Integrin alpha N-terminal domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 144-334
Classification Level Classification E-value
Superfamily vWA-like 1.63e-49
Family Integrin A (or I) domain 0.0000000099
Further Details:      
 
Domain Number 3 Region: 616-772
Classification Level Classification E-value
Superfamily Integrin domains 2.77e-29
Family Integrin domains 0.0093
Further Details:      
 
Domain Number 4 Region: 773-879
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-23
Family Integrin domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022105   Gene: ENSGGOG00000004075   Transcript: ENSGGOT00000024204
Sequence length 978
Comment pep:known_by_projection chromosome:gorGor3.1:16:32035030:32165137:1 gene:ENSGGOG00000004075 transcript:ENSGGOT00000024204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSXXXXXACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSINPYDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFWIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSNEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDNNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGFGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLGLSYRKVSRLQNQRSQ
RSWRLACESASSIEVSGALKSTSCSINHPIFPENSEVRTPGSSPPFLAGWSSFFPSSENN
MPRTNKTEFQQELPVKYAVYMVVTSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDL
PVSINFWVPVELNQEAVW
Download sequence
Identical sequences ENSGGOP00000022105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]