SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022132 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022132
Domain Number 1 Region: 380-523
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 276-381
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-34
Family Second domain of FERM 0.00000447
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.49e-26
Family First domain of FERM 0.0000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022132   Gene: ENSGGOG00000008512   Transcript: ENSGGOT00000024328
Sequence length 982
Comment pep:known_by_projection chromosome:gorGor3.1:6:131439986:131556467:-1 gene:ENSGGOG00000008512 transcript:ENSGGOT00000024328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLR
RQKREKETSESRGISRFIPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEV
KEEKPSVSKEEKPSVSKVETQPTELVSKEREEKVKETQEDKLEGAAAKRETKEVQTNELK
AEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLF
QESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIAS
GRLPCSFVTHALLGSYTLQAELGDYDPEEHGSIDLSEFQFAPTQTKELEEKVAELHKTHR
GLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWP
KILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQP
PKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRSLDGAPIGVMDQSL
MKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPTKAPHLQLIEGKKNSLRVEGDNIY
VRHSNLMLEELDKAQEDILKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGSS
HETLNIVEEKKRAEVGKDERVITEEMNGKEISPGSGPGEIRKVEPVTQKDSTSLSSESSS
SSSESEEEDVGEYRPHHRVTEGTIREEQEYEEEVEEEPRPAAKVVEREEAVPEASPVTQA
GASVITVETVIQENVGAQKIPGEKSVHEGALKQDMGEEAEEEPQKVNGEVSHVDIDVLPQ
IICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGDSGTLL
TAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGDIDHDQALAQAIREAREQH
PDMSVTRVVVHKETELAEEGED
Download sequence
Identical sequences ENSGGOP00000022132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]