SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022146 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022146
Domain Number 1 Region: 737-761,895-1089
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-63
Family G proteins 0.0000000052
Further Details:      
 
Domain Number 2 Region: 784-898
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.7e-34
Family Transducin (alpha subunit), insertion domain 0.000000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022146   Gene: ENSGGOG00000002843   Transcript: ENSGGOT00000023258
Sequence length 1091
Comment pep:known_by_projection chromosome:gorGor3.1:20:56998165:57059967:1 gene:ENSGGOG00000002843 transcript:ENSGGOT00000023258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
IENDGEVCGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEVEQPSLGGFWPTLEQ
RGFPSGVHASLEAFGPALMEPGAFSGARPSLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPATAGSRGGYSPPPEETMPFELDGEGFGDDSPPP
GLSRVIAQVDGSGQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSP
WMEISGPPFEIGSAPAGVDDTPINMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADATERGKVPSPGYGSPAAGAASADSAAGAASADTAARAAPAAPADPDSGAAPEDP
DSRTAPADPDSGAFAADPDSGAAPADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAP
ADPDSGAAPDAPADSDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAH
VAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADPPTPRPT
RASAWRGKSESSRGRRVYYDEGAASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRN
LLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRS
KLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSN
SDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFP
PEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVL
TSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQT
NRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPED
ATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDII
QRMHLRQYELL
Download sequence
Identical sequences ENSGGOP00000002801 ENSGGOP00000022146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]