SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022165 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022165
Domain Number 1 Region: 135-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.27e-23
Family Pentraxin (pentaxin) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022165
Domain Number - Region: 620-906
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00128
Family Rhodopsin-like 0.031
Further Details:      
 
Domain Number - Region: 53-83
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00805
Family C-type lectin domain 0.039
Further Details:      
 
Domain Number - Region: 113-139
Classification Level Classification E-value
Superfamily PRP4-like 0.0968
Family PRP4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022165   Gene: ENSGGOG00000008978   Transcript: ENSGGOT00000026231
Sequence length 951
Comment pep:known_by_projection chromosome:gorGor3.1:9:107842477:107868328:1 gene:ENSGGOG00000008978 transcript:ENSGGOT00000026231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPWGAGERWLHGAAVDRSGVSLGPPPTPQVNQGTLGPQVAPVAPGEVVKTAGGVCKFS
GQRLSWWQAQESCEQQFGHLALQPPDGVLASRLRDPVWVGQREAPLRRPPQRRARTTAVL
VFGERTADRAARLRSPLPELAALTACTHVQWDCASPDPAMLFSVAAPALPNALQLRAFAE
PGGVVRAALVVRGHHAPFLAAFRADGLWHHVCATWEQRGGRWALFSDGHPVPSGGILVLG
QDQDSLGGGFSVRDAFSGNLTDFHLWARALSPAQLHRARACAPPSEGLLFRWDPGALDVA
PSLLPTVWVRLLCPVPSEECPTWNPGPRSEGSELCLQPQPFLCCYRTETYHRLQDAQLWP
GQDVISRVNALANDIVLLPDPLSEVHGALSPAEASSFLGLLEHVLAMEMAPLGPAALLAI
VRFLKRVVALGAGDPELLLTGPWEQLSQGVVSVASLVLEEQVADTWLSLREVVGGPMALV
ASVQRLTPLLSTTMTSEWPRMHIQHRHAGLSGVTVIHSWFTSRVFQHTLEGPDLEPQAPA
SSEEANRVQRFLSIQVGSAIISSEVWDVTGEVNMAVTFHLQHQAQSPLFPPHPPSPYTGG
AWATTGCSMAALYPDSTDCFCNHSTSFAILLQIYEVQRGPEEESLLRTLSFVGCGVSFCA
LTTTFLLFLAAGVPKSERTTVHKNLTFSLASAEGFLMTSEWAKANEVACVAVTVAMHFLF
LVAFSWMLVEGLLLWRKVVAVSMHPGPGMRLYHATGWGVPVGIVAVTLAMLPHDYVAPGH
CWLNVHTNAIWAFVGPVLFVLTANTCILARVVMVTVSSARRRARMLSPQPCLQQQIWTQI
WATVKPVLVLLPVLGLTWLAGILVHLSPTWAYAAVGLNSIQGLYIFLVYAACNEEVRSAL
QRMAEKKVAEVLRALGVWGGAAKEHSLPFSVLPLFLPPKPSTPRHPLRAPA
Download sequence
Identical sequences ENSGGOP00000022165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]