SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022203 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022203
Domain Number 1 Region: 81-162
Classification Level Classification E-value
Superfamily HMG-box 4.58e-32
Family HMG-box 0.0000236
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 4.06e-26
Family HMG-box 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022203   Gene: ENSGGOG00000027164   Transcript: ENSGGOT00000028988
Sequence length 200
Comment pep:known_by_projection chromosome:gorGor3.1:X:148856623:148864072:1 gene:ENSGGOG00000027164 transcript:ENSGGOT00000028988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEDEEEEEEEEEEEEEEDE
Download sequence
Identical sequences A0A2J8S405 A0A2K6NHC3 G3S2A5 H2QZ81 O15347
ENSP00000359393 ENSP00000442758 ENSGGOP00000022203 NP_001288157.1.87134 NP_001288157.1.92137 NP_001288158.1.87134 NP_001288158.1.92137 NP_005333.2.87134 NP_005333.2.92137 XP_004065062.1.27298 XP_004065064.1.27298 XP_008966269.1.60992 XP_010362617.1.97406 XP_010381292.1.97406 XP_016799918.1.37143 ENSP00000405601 gi|71143137|ref|NP_005333.2| ENSP00000359393 ENSP00000442758 ENSP00000472199 ENSP00000472961 ENSPTRP00000038541 9598.ENSPTRP00000038541 9600.ENSPPYP00000023303 9606.ENSP00000359393 ENSGGOP00000010637 ENSPTRP00000038541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]