SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022216 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022216
Domain Number 1 Region: 251-531,583-731
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000144
Family Hermes transposase-like 0.036
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000143
Family THAP domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022216   Gene: ENSGGOG00000006152   Transcript: ENSGGOT00000029571
Sequence length 763
Comment pep:novel chromosome:gorGor3.1:11:73349768:73378443:-1 gene:ENSGGOG00000006152 transcript:ENSGGOT00000029571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFCAAPNCTRKSTQSDLAFFRFPRDPARRCKKWETGCRRIEQKDEPGDVVIKNWIMCP
YRYETCTSCRFESPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKK
IDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGK
QNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQM
LEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLP
YEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTL
CSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKE
LKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNVRWNNYIAGRAFVLCSAVSDFD
FIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEE
ATNLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQH
LKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIEL
PSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSS
NLALLNINFDIKHDLDLMVDTYIKLCTSKSELPTDNSETVENT
Download sequence
Identical sequences ENSGGOP00000006014 ENSGGOP00000022216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]