SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022303 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022303
Domain Number 1 Region: 204-452
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.8e-47
Family ATP-dependent DNA ligase catalytic domain 0.00096
Further Details:      
 
Domain Number 2 Region: 459-604
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-32
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00066
Further Details:      
 
Domain Number 3 Region: 620-748
Classification Level Classification E-value
Superfamily BRCT domain 5.37e-21
Family DNA topoisomerase II binding protein 1, TopBP1 0.045
Further Details:      
 
Domain Number 4 Region: 9-253
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 2.75e-16
Family ATP-dependent DNA ligase DNA-binding domain 0.011
Further Details:      
 
Domain Number 5 Region: 844-911
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000436
Family BRCT domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022303   Gene: ENSGGOG00000027771   Transcript: ENSGGOT00000032537
Sequence length 911
Comment pep:known_by_projection chromosome:gorGor3.1:13:91448830:91456162:-1 gene:ENSGGOG00000027771 transcript:ENSGGOT00000032537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASQTSQTVASHVPFADLCSTLERIQKSRGRAEKIRHFREFLDSWRKFHDALHKNHKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHG
DAGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSA
LEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTD
QFGASPTEGSLTPFIHNAFKTDIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNE
AIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMM
SHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILC
GTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLE
QLRGKASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFE
DVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSKNIRVKNIILSNKHDV
VKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSG
IKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAI
KALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDK
CELQEENQYLI
Download sequence
Identical sequences G3S2K5
ENSGGOP00000022303 XP_004054771.1.27298 XP_018895456.1.27298 ENSGGOP00000022303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]