SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022304 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022304
Domain Number 1 Region: 176-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 239-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000243
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 52-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000011
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 113-174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000012
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022304   Gene: ENSGGOG00000003026   Transcript: ENSGGOT00000028625
Sequence length 488
Comment pep:known_by_projection chromosome:gorGor3.1:1:203668290:203830735:-1 gene:ENSGGOG00000003026 transcript:ENSGGOT00000028625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPE
NGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRI
PQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPL
ASSNGYVNISEFQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEAQV
CPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQVYC
IKSEQTWPSAHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSSSS
DPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDTDT
GPGESETCDSISGSSELLQSLYSPPRCQESTHPASNNPDTIASTAEEVASTSPGIDIADE
IPLMEEDP
Download sequence
Identical sequences ENSGGOP00000022304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]