SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022306 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022306
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 2.1e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.55e-23
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022306   Gene: ENSGGOG00000028551   Transcript: ENSGGOT00000026811
Sequence length 419
Comment pep:known_by_projection chromosome:gorGor3.1:11:127134031:127162568:1 gene:ENSGGOG00000028551 transcript:ENSGGOT00000026811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
Download sequence
Identical sequences A0A024R3K7 A0A2I3TVD0 G3S2K8
ENSGGOP00000022306 XP_004052475.1.27298 XP_008971550.1.60992 XP_016777752.1.37143 XP_018891281.1.27298 ENSGGOP00000022306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]