SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022328 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022328
Domain Number 1 Region: 315-396
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022328   Gene: ENSGGOG00000005130   Transcript: ENSGGOT00000025120
Sequence length 401
Comment pep:known_by_projection chromosome:gorGor3.1:2a:16273147:16278075:1 gene:ENSGGOG00000005130 transcript:ENSGGOT00000025120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQELAHPAAECVDPAVVFPFPVNKREPAPVPAAP
TSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTITVRP
KNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYMESEDAPPQKKIKSEASPRPLKSVI
PPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVIL
KKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
Download sequence
Identical sequences ENSGGOP00000022328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]