SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022349 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022349
Domain Number 1 Region: 3775-3993
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-78
Family Fibrinogen C-terminal domain-like 0.00000264
Further Details:      
 
Domain Number 2 Region: 1031-1199
Classification Level Classification E-value
Superfamily Fibronectin type III 5.11e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 3511-3599
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-18
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 3599-3761
Classification Level Classification E-value
Superfamily Fibronectin type III 8.03e-18
Family Fibronectin type III 0.00000337
Further Details:      
 
Domain Number 5 Region: 2601-2684
Classification Level Classification E-value
Superfamily Fibronectin type III 1.82e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 2067-2150
Classification Level Classification E-value
Superfamily Fibronectin type III 2.82e-17
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 7 Region: 1551-1640
Classification Level Classification E-value
Superfamily Fibronectin type III 5.09e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 8 Region: 2810-2994
Classification Level Classification E-value
Superfamily Fibronectin type III 5.42e-17
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 9 Region: 2275-2358
Classification Level Classification E-value
Superfamily Fibronectin type III 8.13e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 10 Region: 2486-2576
Classification Level Classification E-value
Superfamily Fibronectin type III 1.15e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 11 Region: 1652-1735
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 12 Region: 2702-2792
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 13 Region: 2167-2249
Classification Level Classification E-value
Superfamily Fibronectin type III 2.49e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 14 Region: 3316-3398
Classification Level Classification E-value
Superfamily Fibronectin type III 3.43e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 15 Region: 3113-3197
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-16
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 16 Region: 3203-3291
Classification Level Classification E-value
Superfamily Fibronectin type III 4.1e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 17 Region: 2383-2465
Classification Level Classification E-value
Superfamily Fibronectin type III 4.48e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 18 Region: 3414-3507
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000139
Family Fibronectin type III 0.00000201
Further Details:      
 
Domain Number 19 Region: 1234-1316
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000182
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 20 Region: 807-895
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000193
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 21 Region: 1745-1831
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000348
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 22 Region: 1445-1530
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000459
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 23 Region: 1846-1934
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000143
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 24 Region: 3024-3111
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000386
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 25 Region: 1957-2039
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000221
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 26 Region: 726-807
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000449
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 27 Region: 928-1008
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000168
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022349
Domain Number - Region: 593-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 563-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 222-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 253-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 284-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 346-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00349
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 160-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 501-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Integrin beta EGF-like domains 0.078
Further Details:      
 
Domain Number - Region: 439-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 408-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Integrin beta EGF-like domains 0.059
Further Details:      
 
Domain Number - Region: 377-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 470-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 314-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 191-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 532-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0433
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 692-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022349   Gene: ENSGGOG00000012983   Transcript: ENSGGOT00000028092
Sequence length 4000
Comment pep:known_by_projection chromosome:gorGor3.1:6:32933669:32987839:-1 gene:ENSGGOG00000012983 transcript:ENSGGOT00000028092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPGT
EPPVPASEVQALRVRLEILEELVKGLKEQCTGGCCSASAQAGTGQTDVRTLCSLHGVFDL
SRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGP
SCGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYT
GDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCEDGRCVCDPG
YTGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICD
TGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVCV
CNAGYSGEDCGVRSCPGDCRGRGRCESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGR
CVCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLD
GRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVGEDCSIRTCPSNCHGRGRC
EEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGG
CGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPT
IEGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFTARVPSSASAYDQRGLA
PGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDRFV
VSYVSAGNQRVRLEVPPEADGTLLTDLMPGVEYVVTVTAERGRAVSYPASVRANTGSSPS
GLLGTTDEPPPSGPSTTQGAQAPLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAHF
QLRMRVPEGPGAHEEVLPGDVRQAVVPPPPPGTLYELSLHGVPPGGKPSDPIIYQGIMDK
DEEKPGKSSGPPRLGELTVTDRTSDSLLLRWTVPEGEFDSFMIQYKDRDGQPQVVPVEGP
QRSAVITSLDPGRKYKFVLYGFVGKKRHGPLVAEAKILPQSDPSPGTPPRLGNLWVTDPT
PDSLHLSWTVPEGQFDTFMVQYRDRDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIA
NKKRYGPLTADGTTAPERKEEPPRPEFLEQPLLGELTVTGVTPDSLRLSWTVAQGPFDSF
MVQYKDAQGQPQAVPVAGDENEVTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPDS
LTPSPLGRGAVIPEPAREGHAPPWIPLTPEFFSHSCLEPCLSNSFLGVKGEGGAGLPGEA
TARAHSMLLSQTRRETPHPHRTHQSGMGQGLSQPSPSVSDRMEDVDETPSPTELGTEAPE
SPEEPLLGELTVTGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVG
GLEPGHKYKMHLYGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPN
SVGLSWTVPEGQFDSFMVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDG
QRMGPLSVVIMTAPLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFV
VQYKDRDRQPQVVPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGD
ASPGAPPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTV
TPLDASRKYRFLLYGLLGKKRHGPLTADGTTEAQSAMDDTGTKRPPKPRLGEELQVTTVT
QNSVGLSWTVPEGQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLH
RGKRVGPISAVAITASREETETETTAPTPPAPEPHLGELTVEEATPHTLHLSWMVTEGEF
DSFEIQYTDRDGQLQMVRTGGDRNDITLSGLESDHRYLVTLYGFRDGKHVGPVHVEALTD
GWESPEEEEEPSEPPTATPEPPIKPRLGELTVTDATPDSLSLSWTVPEGRFDHFLVQYRN
GDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRMGPVSVVGVTAPEEESPDAP
LAKLRLGEMTVRDITSDSLSLSWTVPEGQFDHFLVQYKNGDGQPKAVRVPGHEDGVTISG
LEPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGKDEEMAPASTEPPTPEPPIKPRLGELTV
TDATPDSLSLSWMVPEGQFDHFLVQYKNGDGQPKATRVPGHEDRVTISGLEPDHKYKMNL
YGFHGGQRVGPVSAIGVTGPPQLTLELVMLLPPFPHNEEPLLGELTVTGSSPDSLSLSWT
VPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVS
TVGVTAPQEDVDETPSPTEPGTEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSF
TVQYKDRDGRPQAVRVGGQESEVTVRGLEPGRKYKMHLYGLHEGQRLGPVSAVGVTAPED
EAETTQAVPTMTPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPK
AVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTEPSTEA
PEPPEEPLLGELTVTGSSPDSLSLSWTVPQGHFESFTVQYKDRDGRPQVVRVRGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPEDEAETTQAVPTMTPEPPNKPRLGEL
TVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVLGHEDGVTISGLEPDHKYKM
NLYGFHGGQRVGPISVTGVTAAEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDSLSL
SWTVPQGRFDSFTVQYKDRDGRPQAVHVRGEESEVTVGGLEPGRKYKMHLYGLHEGQRVG
PVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDVQGQPQ
AVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTSPDTKPSPRLGELTVT
DATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPVAANQREVTVQGLEPRRKYRFLLY
GLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEETSSSLRLSWTVAQGPFDSFVVQYR
DTDGQPRAVPVAADQRAVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEEDTPAP
ELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLVDG
DQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGPAPAGQTSAESRPRLSQLSVT
DVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLR
SGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSRAD
SFKVSYQLADGGEPQSVQVDGQARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLTTV
PDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAETPGSAVDYPLHDLV
LHTNYTATVRGLRGPNLTSPATITFTTGLEAPRDLEAKEVTPRTALLTWTEPQVRPTGYL
LSFDTPGGQTQEILLPGGITSHQLLGLFPSTPYNARLQAMWGQSLLPPVSTSFTTGGLQI
PFPRDCGEEMQNGASASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWR
DWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRARDEAVFAQYDSFRVDSAAEY
YRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNNLLISCAVSYRGAWWYRNCHYANLNGLY
GSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
Download sequence
Identical sequences ENSGGOP00000022349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]