SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022359 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022359
Domain Number 1 Region: 13-76
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000000791
Family beta-Galactosidase/glucuronidase domain 0.0000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022359   Gene: ENSGGOG00000025375   Transcript: ENSGGOT00000028751
Sequence length 119
Comment pep:novel chromosome:gorGor3.1:17:26295219:26299150:1 gene:ENSGGOG00000025375 transcript:ENSGGOT00000028751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPKPWSLLPPAGLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLW
WPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGEPGGPHPISPCLCL
Download sequence
Identical sequences ENSGGOP00000022359 PGOCHP00000173656 9606.ENSP00000381977 9606.ENSP00000398416 ENSGGOP00000022359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]