SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022362 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022362
Domain Number 1 Region: 59-257
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 1.28e-52
Family Apolipoprotein A-I 0.0002
Further Details:      
 
Domain Number 2 Region: 211-363
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 1.44e-37
Family Apolipoprotein A-I 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022362   Gene: ENSGGOG00000028447   Transcript: ENSGGOT00000031693
Sequence length 396
Comment pep:known_by_projection chromosome:gorGor3.1:11:114717686:114720277:-1 gene:ENSGGOG00000028447 transcript:ENSGGOT00000031693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLKAVVLTLALVAVTGARAEVSADQVAMVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEELRARLLPHANEV
SQKIGDNVRELQQRLEPYADQLRTQVNTQAEQLRRQLIPYTERMERVLRENADSLRASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LAFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPYAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQPQEQVQMLAPLES
Download sequence
Identical sequences G3S2R4
XP_004052227.1.27298 ENSGGOP00000022362 ENSGGOP00000022362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]