SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022405 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022405
Domain Number 1 Region: 255-326
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000246
Family LIM domain 0.013
Further Details:      
 
Domain Number 2 Region: 193-260
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000106
Family LIM domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022405
Domain Number - Region: 165-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000137
Family LIM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022405   Gene: ENSGGOG00000027840   Transcript: ENSGGOT00000026247
Sequence length 370
Comment pep:known_by_projection chromosome:gorGor3.1:19:31733645:31752449:1 gene:ENSGGOG00000027840 transcript:ENSGGOT00000026247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLVPGPPLEASPTTLDAAVRWGLQRPVRGHMAPGQAGGRGDASALGARYSSARDGRSA
VGSKLSWVGPAAPESKAAQGREMGRDVGNAVYCLDLSGPDGASCLQLSLRKSELFPAARR
PGRPADPGLSPRCLRRPPLRPLEALTRELERALEARTARDYFGICIKCGLGIYGAQQACQ
AMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEM
ILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPA
QGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPL
PSPTVHVTEL
Download sequence
Identical sequences ENSGGOP00000022405 ENSGGOP00000022405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]