SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022416 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022416
Domain Number 1 Region: 404-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-52
Family DBL homology domain (DH-domain) 0.0000885
Further Details:      
 
Domain Number 2 Region: 630-763
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-26
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000393
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022416   Gene: ENSGGOG00000014640   Transcript: ENSGGOT00000025597
Sequence length 1083
Comment pep:known_by_projection chromosome:gorGor3.1:1:6542252:6595986:-1 gene:ENSGGOG00000014640 transcript:ENSGGOT00000025597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSVLTKHGSPPQSWLSLCSGTDDESPAEKKGLRCQNPACMDKGRAAKVCHHADCQQLHR
RGPLNLCEACDSKFHSAMHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEEE
ENSVDGKGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGE
VLLPVFERKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKGEKQPGPNGAAGTGGA
SWRWAPFPGXXXXXXXXXXXERVDPQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPT
PSSCSLPGGSSGSTNSGDSWKNRAASRFSGFFSSGPSTSAFGREVDKMEQLEGKLHTYSL
FGLPRLPRGLRFDHDSWEEEDDEDEDEDNACLRLEDSWRELIDGHEKLTRRQCHQQEAVW
ELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVM
APVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAY
ITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFI
HHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEET
RQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTRVIRPPLLVDKIVCRELR
DPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTIYNAQNQLQQLRAQEPPGSQQPLQ
SLEEEEDEQEEEEEEEEEEEGEDSGTSAASSPTIMRKSSGSPDSQHCASDGSTETLAMVV
VEPGHTLSSPEFDGGPFSSQSDETSLSTTASSATPTSELLPLGPVDGRSCSMDSAYGTLS
PTSLQDFVAPGPMAELVPRAPESPQAPSPPPSPRLRRRTPVQLLTCPPYLLKSKSEASLL
QLLAGAGTHGTPSAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVS
CLAGEPAGSHRKRCGDPPSGASPRVQPEPLPGVSAQHRKLTLAQLYRIRTTLLLNSTLTA
SEV
Download sequence
Identical sequences ENSGGOP00000022416 ENSGGOP00000014293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]