SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022420 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022420
Domain Number 1 Region: 178-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.95e-20
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.91e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 296-358
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.15e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 151-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000981
Family LIM domain 0.012
Further Details:      
 
Domain Number 5 Region: 355-384
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000113
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022420   Gene: ENSGGOG00000001916   Transcript: ENSGGOT00000030638
Sequence length 386
Comment pep:known_by_projection chromosome:gorGor3.1:11:55226185:55275317:-1 gene:ENSGGOG00000001916 transcript:ENSGGOT00000030638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELDALLEELERSTLQDNDEYSNPAPLPLDQHSRKETNLDETSEILSVQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKGSPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHTLGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL
Download sequence
Identical sequences G3S2X2
XP_004051270.1.27298 ENSGGOP00000022420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]