SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022424 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022424
Domain Number 1 Region: 292-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-42
Family SPRY domain 0.00008
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-27
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.23e-17
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022424   Gene: ENSGGOG00000014804   Transcript: ENSGGOT00000024063
Sequence length 493
Comment pep:known_by_projection chromosome:gorGor3.1:11:5631077:5652994:-1 gene:ENSGGOG00000014804 transcript:ENSGGOT00000024063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLTEEVAQEYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKRLTKSETEMVQQTQSVRELISDLERRLQ
GSVMELLQGVDGVIKRMENVTLKKPETFPKNRRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDMRQVSSPKPQIIYGAQGTRYQTFMNFNYCTGILGSQSITSGKHY
WEVDVSKKSAWILGVCAGFQPDATCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDGSFHT
PSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
KCRVPMTLCSPSS
Download sequence
Identical sequences G3S2X6
ENSGGOP00000022424 XP_018891206.1.27298 XP_018891207.1.27298 XP_018891208.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]