SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022428 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022428
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily EF-hand 1.61e-37
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 2 Region: 145-238
Classification Level Classification E-value
Superfamily EF-hand 1.74e-30
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 3 Region: 221-299
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-21
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022428   Gene: ENSGGOG00000003601   Transcript: ENSGGOT00000026121
Sequence length 749
Comment pep:known_by_projection chromosome:gorGor3.1:18:31872900:32173241:1 gene:ENSGGOG00000003601 transcript:ENSGGOT00000026121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDSGKRGNTMAERRQLFAEMTLGAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNV
IEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAA
FDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLP
TAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVF
HPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKK
LTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPF
ITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNPS
CMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELEN
KNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRE
LMVQLEGLMKLLKEEELKQGTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSL
TGVGGDVQEAFAQSSRRNLRNDLLVAADSITNTMSSLVKELNSEVGSETESNVDSEFART
QFEDLVPSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDADPYVRPEDENYENDS
VRQLENELQMEEYLKQKLQDEAYQVSLQG
Download sequence
Identical sequences ENSGGOP00000003545 ENSGGOP00000022428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]