SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022444
Domain Number 1 Region: 602-738
Classification Level Classification E-value
Superfamily EF-hand 0.00000000134
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 432-485,522-646
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000369
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022444   Gene: ENSGGOG00000003323   Transcript: ENSGGOT00000025483
Sequence length 928
Comment pep:known_by_projection chromosome:gorGor3.1:4:96977665:97048248:1 gene:ENSGGOG00000003323 transcript:ENSGGOT00000025483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSSRVQPQQPGDAGCAAVGASLASPGGLREQRGLEIEMQRIRPPSPPLSSCSRQAWSR
DNPGFEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQ
GPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSV
LRELVTYLLFLIVLCILTYGMMSSNVYYYTQMMSQLFLDTPVSKTEKTNFKTLSSMEDFW
KFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDE
IKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTRE
ETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPL
KLIRYVTTFDFFLAACEIIFCFFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVV
AIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFN
RTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRII
LGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMEL
SDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFT
KYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDS
GHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREV
LGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPR
PRSSRPSSSQSTEGMEGAGGNGSSNVHV
Download sequence
Identical sequences ENSGGOP00000022444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]