SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022457 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022457
Domain Number 1 Region: 280-496
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.75e-90
Family Fibrinogen C-terminal domain-like 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022457   Gene: ENSGGOG00000023090   Transcript: ENSGGOT00000023165
Sequence length 498
Comment pep:known_by_projection chromosome:gorGor3.1:8:106603128:106853411:-1 gene:ENSGGOG00000023090 transcript:ENSGGOT00000023165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
Download sequence
Identical sequences A0A2I3TSA7 G3S307 H2PR10 Q15389
gi|20532340|ref|NP_001137.2| ENSPTRP00000035064 ENSP00000428340 ENSGGOP00000022457 ENSP00000428340 ENSP00000297450 ENSGGOP00000022457 ENSPPYP00000021113 9598.ENSPTRP00000035064 9600.ENSPPYP00000021113 9606.ENSP00000297450 NP_001137.2.87134 NP_001137.2.92137 XP_002819393.1.23681 XP_004047476.1.27298 XP_519904.3.37143 ENSPTRP00000035064 ENSPPYP00000021113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]