SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022492 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000022492
Domain Number - Region: 277-493
Classification Level Classification E-value
Superfamily Tropomyosin 0.00111
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 582-616
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.017
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022492   Gene: ENSGGOG00000016277   Transcript: ENSGGOT00000024167
Sequence length 1851
Comment pep:known_by_projection chromosome:gorGor3.1:18:8774028:8901317:1 gene:ENSGGOG00000016277 transcript:ENSGGOT00000024167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLNGPAGGGAPDAKLQPPGQHHRHHHLHPPNLAGKAPPSPGSLAAPGRLSRRSGGVPG
AKDRAAGGAKAALGSRRATRVAPAEPLSRAGKPPGAEPPSAAAKGRKAKRGSRAPPARTI
GPPTPAARIPAVTLAVTSVAGSPARCSRISHTDSSSDLSDCPSEPLSDEQRLLPAASSDA
ESGTGSSDREPPRGAPTPSPAARGAPPGSPEPPALLAAPLAAGACPGGRSIPGGVSGGFA
GPGVAEDVRGRSPPERPVPGTPKEPSLGEQSRLVPASEEEELLREMEELRSENDYLKDEL
DELRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQKSLKVAETGQVD
GELIRSLEQDLKVAKDVSVRLHHELKTVEEKRAKAEDENETLRQQMIEVEISKQALQNEL
ERLKESSLKRRSTREMYKEKKTFNQDDSADLRCQLQFAKEEAFLMRKKMAKLGREKDELE
QELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEANILGRKIVELEVENRG
LKAEMEDMRGQQEREGPGRDHAPSIPTSPFGDSLESSTELRRHLQFVEEEAELLRRSISE
IEDHNRQLTHELSKFKFEPPREPGWLGEGASPGAGGGAPLQEELKSARLQISELSGKVLK
LQHENHALLSNIQRCDLAAHLGLRAPSPRDSDAESDAGKKESDGEESRLPQPKREGPVGG
ESDSEEMFEKTSGFGSGKPSEASEPCPTELLKAREDSEYLVTLKHEAQRLERTVERLITD
TDSFLHDAGLRGGAPLPGPGLHGEEEQGEGDQQEPHLLGTINAKMKAFKKELQAFLEQVN
RIGDGLCPLPHLTESSSFLSTVTSVSRDSPIGNLGKELGPDLQSRLKEQLEWQLGPARGD
ERETLRLRAARELHRRADGDAGSHGLGGQTCFSLEMEEEHLYALRWKELEMHSLALQNTL
HERTWSDEKNLMQQELRSLKQNIFLFYVKLRWLLKHWRQGKQMEEEGEDFTEGEHPETLS
GLGELGVQGGHQADGPDHDSDRGCGFPVGEHSPHSRVQIGDHSLRLQTADRGQSHKQVVE
NQQLFSAFKALLEDFRAELREDERARLRLQQQYASDKAAWDVEWAVLKCRLEQLEEKTEN
KLGELGSSAESKGALKKEREVHQKLLADSHSLVMDLRWQIHHSEKNWNREKVELLDRLDR
DRQEWERQKKELLWRIEQLQKENSPRRGGSFLCDQKDGNVRPFPHQGSLRMPRPVAMWPC
ADADSIPFEDRPLSKLKESDRCSASENLYLDALSLDDEPEEPPAHRPEREFRNCLPEEEE
NHKGNLQRAVSVSSMSEFQRLMDISPFLPEKGLPSTSSKEDVTPPLSPDDLKYIEEFNKS
WDYTPNRGHNGGGPDLWADRTEVGRAGHEDSTEPFPDSSWYLTTSVTMTTDTMTSPEHCQ
KQPLRSHVLTEQSGLRVLHSPPAVRRVDSITAAGGEGPFPTSRARGSLGDTKGGPPEPVL
SRWPCTSPRHSRDYVEGARRPLDSPLCTSLGFASPLHSLEMSKNLSDDMKEVAFSVRNAI
CSGPGELQVKDMACQTNGSRTMGTQTVQTISVGLQTEALRGSGVTSSPHKCLTPKAGGGA
TPVSSPSRSLRSRQVAPAIEKVQAKFERTCCSPKYGSPKLQRKPLPKADQPNNRTSPGMA
QKGYSESAWARSTTTRESPVHTTINDGLSSLFNIIDHSPVVQDPFQKGLRAGSRSRSAEP
RPELGPGQETGTNSRGRSPSPIGVGSEMCREEGGEGTPVKQDLSAPPGYTLTENVARILN
KKLLEHALKEERRQAAHGPPGLHSDSHSLGDTAEPGPMENQTVLLTAPWGL
Download sequence
Identical sequences ENSGGOP00000022492 ENSGGOP00000022492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]