SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022506 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022506
Domain Number 1 Region: 21-59
Classification Level Classification E-value
Superfamily SAP domain 0.0000000174
Family SAP domain 0.0037
Further Details:      
 
Domain Number 2 Region: 371-419
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000706
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022506   Gene: ENSGGOG00000015866   Transcript: ENSGGOT00000032588
Sequence length 1040
Comment pep:known_by_projection chromosome:gorGor3.1:15:38035170:38091506:-1 gene:ENSGGOG00000015866 transcript:ENSGGOT00000032588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAGPGAVAASAASGQAEGKKITDLRVIDLKSELKRRNLDITGVKTVLISRLKQAIEEEG
GDPDNIELTVSTDTPNKKPTKGKGKKHEADELSGDASVEDDAFIKDCELENQEAHEQDGN
DELKDSEEFGENEEENVHSKELLSAEENKRAHELIEAEGIEDIEKEDIESQVFSQFFLKH
DDTFLTAQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAE
DDNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEM
NANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSSTGASGQAKSSSKESK
DSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKISSPVMEKNN
LIRSCYKSCEGKVHSIEITELVTIIVKLYEDTIYLVRRPVELKIKWLWSKSAFPRVEVKA
LCLYSSLFTTESFSLFSSHSSIPALSLLTNHLTQLQLFVIKVLTLINKILETFSKDIQGG
PMATYLRGGNKYKKLGSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKK
RDKDYRRKEILPFEKMKEQRLREHLVRFERLRRAMELRRRREIAERERRERERIRIIRER
EERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIAREREELRRQQQ
QLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHR
ERGRFPESSAVQSSSFERRDRFVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPP
RNELRESDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKSEGSMSTDKR
ETRVERPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVV
ERHGRDTSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSNASPINRIVQISGNS
MPRGSGSGFKPFKGGPPRRF
Download sequence
Identical sequences ENSGGOP00000022506 ENSGGOP00000015482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]